SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000037570 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000037570
Domain Number 1 Region: 1781-2026
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-53
Family Ankyrin repeat 0.0000000637
Further Details:      
 
Domain Number 2 Region: 380-513
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000018
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 800-935
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000345
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 4 Region: 609-732
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000746
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 1112-1257
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 512-626
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000314
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 238-285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000159
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 913-1042
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000022
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 9 Region: 276-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000572
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 10 Region: 148-274
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000173
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 11 Region: 1082-1125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000274
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 1339-1377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000447
Family EGF-type module 0.017
Further Details:      
 
Domain Number 13 Region: 1469-1502
Classification Level Classification E-value
Superfamily Notch domain 0.0000000693
Family Notch domain 0.0035
Further Details:      
 
Domain Number 14 Region: 1250-1300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000798
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 738-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000084
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 16 Region: 313-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 17 Region: 46-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000039
Family EGF-type module 0.042
Further Details:      
 
Domain Number 18 Region: 1388-1420
Classification Level Classification E-value
Superfamily Notch domain 0.00000222
Family Notch domain 0.0014
Further Details:      
 
Domain Number 19 Region: 1428-1460
Classification Level Classification E-value
Superfamily Notch domain 0.00000248
Family Notch domain 0.0049
Further Details:      
 
Domain Number 20 Region: 1054-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000697
Family EGF-type module 0.033
Further Details:      
 
Domain Number 21 Region: 123-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000198
Family EGF-type module 0.017
Further Details:      
 
Domain Number 22 Region: 355-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000021
Family EGF-type module 0.023
Further Details:      
 
Domain Number 23 Region: 82-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000042
Family EGF-type module 0.018
Further Details:      
 
Domain Number 24 Region: 775-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000715
Family EGF-type module 0.033
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000037570
Domain Number - Region: 1293-1328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00447
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000037570   Gene: ENSRNOG00000004346   Transcript: ENSRNOT00000037456
Sequence length 2319
Comment pep:known chromosome:Rnor_5.0:7:14294587:14345774:-1 gene:ENSRNOG00000004346 transcript:ENSRNOT00000037456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGARGRRRRRRLMALPPPPPPMRALPLLLLLLAGLGAAAPPCLDGSPCANGGRCTHQQ
PSREAACLCLPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGVARFSCRCLRGFRGPDCS
LPDPCFSSPCAHGAPCSVGSDGRYACACPPGYQGRNCRSDIDECRAGASCRHGGTCINTP
GSYHCLCPLGYTGLLCENPIVPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCEVNVD
DCPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGGH
SCVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSN
PCHEDAICDTNPVSGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQ
CGRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTFCEVDIDECQSSPC
VNGGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFE
GTLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGIRCESQVDECRSQPCRYGGKCL
DLVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEI
NECASSPCGEGGSCVDGENGFHCLCPPGSLPPLCLPVNHPCAHKPCSHGVCHDAPGGFQC
VCEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFHCTCAPGFQGHQCEVLSPCTPS
LCEHGGHCESDPDQLTVCSCPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGSFRCICH
GGYTGPFCDQDIDDCDPNPCLNGGSCQDGVGSFSCSCLSGFAGPRCARDVDECLSSPCGP
GTCTDHVASFTCTCPPGYGGFHCETDLLDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGTH
CQYKVDPCFSRPCLHGGICNPTHSGFECTCREGFTGNQCQNPVDWCSQAPCQNGGRCVQT
GAYCICPPEWSGPLCDIPSLPCTEAAAHMGVRLEQLCQAGGQCIDKDHSHYCVCPEGRMG
SHCEQEVDPCTAQPCQHGGTCRGYMGGYVCECPAGYSGDSCEDDVDECASQPCQNGGSCI
DLVAHYLCSCPPGTLGVLCEINEDDCGPGPSLDSGLRCLHNGTCVDLVGGFRCNCPPGYT
GLHCEADINECRPGTCHAAHTRDCLQDPGGHFRCICLPGFTGPRCQTALFPCESQPCQHG
GQCRPSLGRGGGLTFTCHCVQPFWGLRCERVARSCRELQCPVGIPCQQTARGPRCACPPG
LSGPSCRVSRASPSGATNTSCAATPCLHGGSCLPVQSVPFFRCVCAPGWGGPRCETPSAA
PEVPEEPRCPRAACQAKRGDQNCDRECNSPGCGWDGGDCSLNVDDPWRQCEALQCWRLFN
NSRCDPACSSPACLYDNFDCYSGGRDRTCNPVYKKYCADHFADGRCDQGCNTEECGWDGL
DCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDARGQAMVFPY
HRPSPGSESRVRRELGPEVIGSVVMLEIDNRLCLKSAENDHCFPDAQSAADYLGALSAVE
RLDFPYPLRDVRGEPLEPPEQSVPLLPLLVAGAVFLLVIFVLGVMVARRKREHSTLWFPE
GFALHKDIAAGHKGRREPVGQDALGMKNMTKGESLMGEVATDWNDSECPEAKRLKVEEPG
MGAEEPVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASF
CGGALEPMPAEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRL
LDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTXLDARMADGSTALILAARLAV
EGMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFL
AAREGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPSGPHG
LGPLLCPPGAFLPGLKAVQSGTKKSRRPPGKTGLGPQGTRGRGKKLTLACPGPLADSSVT
LSPVDSLDSPRPFGGPPASPGGFPLEGPYATTATTVSLAQLGASRAGPLGRQPPGGCVLS
LGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGSQLLNPATPVSPHERPPPYLAAPGHGE
EYPAAGTHSSPTKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATSA
TAAGALPAQPHPISVPSLPQSQTQLGPQPEVTPKRQVMA
Download sequence
Identical sequences F1LQX7
ENSRNOP00000037570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]