SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000038037 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000038037
Domain Number 1 Region: 690-887
Classification Level Classification E-value
Superfamily Sec7 domain 4.06e-68
Family Sec7 domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 56-192,393-573,1000-1051,1095-1165
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000544
Family Armadillo repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000038037   Gene: ENSRNOG00000026048   Transcript: ENSRNOT00000036156
Sequence length 1861
Comment pep:known chromosome:Rnor_5.0:1:273335046:273464048:1 gene:ENSRNOG00000026048 transcript:ENSRNOT00000036156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDKNIYIIQGEINIVVGAIKRNARWSTHIPLDEERDPLLHSFSHLKEVLNSGTELSEIE
PNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSCALIDPTHEGTAEGMENMADAVTHAR
FVGTDPASDEVVLMKILQVLRTLLLTPVGTHLTNESVCEIMQSCFRICFEMRLSELLRKS
AEHTLVDMVQLLFTRLPQFKEEPKSYVGTNLKKLKMRAGGMSDSSKWKKQKRSPRPPRHT
TKVMPGSELPTPNGAALSSNLTGGMPFIEAPTSISSASSEAASTVVSPCTDSGLELSSQA
TSKEDLTDLEQAGSPREITTTEPGSTEIGVSDQLDPQEGAHVEKAQSASVESIPEVLEEC
TSPTDHSDSASVHDMDYVNPRGVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDR
HNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSVERLNLYAASLRVC
FLLFESMREHLKFQLEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYI
NYDCDYYCSNLFEDLTKLLSKNAFPVSGQLYTTHLLSLDALLTVIDSTEAHCQAKVLNTL
NQQEKKETARPGFEAVDGSPDTYKSERAASDGKATGVPSDAPGLHFSSGGWLSTEHGKPG
CSDLEEAGDSGVDKKTTRKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQF
LQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNMDLLESFVSTFSFQGLRLDE
ALRLYLEAFRLPGEAPVIHRLLEVFTEHWRSCNGSPFANSDACFALAYAVIMLNTDQHNH
NVRKQNAPMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVW
SVLLHRGATPEGIFLRVPPGSYDLDLFTMTWGPTIAALSYVFDKSLEETIIQKAISGFRK
CAMISAHYGLSDVFDNLIISLCKFTALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHG
DILREGWKNIMEAMLQLFRAQLLPKAMVEVEDFVDPNGKISLQREETPSNRGESTVLSFV
SWLTLSGPEQSSVRGPSTENQEAKRVALDCIKQCDPEKMITESKFLQLESLQELMKALVS
VTPDEETYDEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAV
VGLLRLAIRLLRREEISGQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSG
DDWATLFTLLECIGSGVKPPDALQATARADAPDAGAQSDSELPSYHQNDVSLDRGYTSDS
EVYTDHGRPGKMHRSATDADMANSGWLVVGKDDIDNSKPAAGLSRPGPSPLVNQYSLTVG
LDLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQDKRGK
SHKYDSKGNRFKKKPKEGSMLRRPRASSQHATRAGHSDEEEDEGVPASYHTVSLQVSQDL
LDLMHTLHTRAASIYSSWAEEQRHLETGGRKIEADSRTLWAHCWCPLLQGIACLCCDARR
QVRMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGMEETRMR
ASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSSDLLSEAVPESLKNMLLVM
DTAEIFHSADARGGSPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPTEPHSQKPLAS
THLTPAAGDPRMPGHPPPPEIPSEVGACDPEKPESTRAASSSSPGSPVASSPSKQSPAPE
GPPPLAQPPLILQPLTSPLQVGVPPMTLPIILNPALIEATSPVPLLATPRPTDPIPTSEV
N
Download sequence
Identical sequences F1M8X9
NP_001178563.1.100692 NP_001178563.1.4139 ENSRNOP00000038037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]