SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000038651 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000038651
Domain Number 1 Region: 204-467
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-81
Family Nuclear receptor ligand-binding domain 0.000000000224
Further Details:      
 
Domain Number 2 Region: 99-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-27
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000038651   Gene: ENSRNOG00000021463   Transcript: ENSRNOT00000030082
Sequence length 468
Comment pep:known chromosome:Rnor_5.0:7:126330833:126392748:1 gene:ENSRNOG00000021463 transcript:ENSRNOT00000030082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSLGEESSGSFSFADYQYLGSC
PGSEGSVITDTLSPASSPSSVSCPAVPTSTDESPGNALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLAYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDLKDSETADLKSLAKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFV
IHDMETLCMAEKTLVAKMVANGVENKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDT
FLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
Download sequence
Identical sequences P37230
NP_037328.1.100692 NP_037328.1.4139 XP_006242218.1.100692 XP_017450169.1.100692 XP_017450170.1.100692 10116.ENSRNOP00000038651 ENSRNOP00000038651 ENSRNOP00000038651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]