SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000039308 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000039308
Domain Number 1 Region: 61-170
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-25
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 2 Region: 256-362
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 7.39e-20
Family Platelet-derived growth factor-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000039308   Gene: ENSRNOG00000029148   Transcript: ENSRNOT00000049325
Sequence length 370
Comment pep:known chromosome:Rnor_5.0:8:4454510:4682165:1 gene:ENSRNOG00000029148 transcript:ENSRNOT00000049325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRLILVSILVCANFCCYRDTFATPQSASIKALRNANLRRDESNHLTDLYRRDENIRVTG
TGHVQSPRFPNSYPRNLLLTWRLHSQEKTRIQLAFDHQFGLEEAENDICRYDFVEVEDVS
ESSTVVRGRWCGHKEIPPRITSRTNQIKITFQSDDYFVAKPGFKIYYSFVEDFQPEAASE
INWESVTSSFSGVSYHSPSVMDSTLTADALDKAIAEFDTVEDLLKYFNPASWQDDLENLY
MDTPRYRGRSYHERKSKVDLDRLNDDVKRYSCTPRNHSVNLREELKLTNAVFFPRCLLVQ
RCGGNCGCGTLNWKSCTCSSGKTVKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERC
DCICSSRPPR
Download sequence
Identical sequences Q9EQT1
NP_076452.1.100692 NP_076452.1.4139 ENSRNOP00000039308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]