SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000040374 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000040374
Domain Number 1 Region: 414-525
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-22
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 595-701
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-20
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 3 Region: 708-773
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000594
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 767-829
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000197
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 354-419
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000459
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 834-894
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000223
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 237-355
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000798
Family Spermadhesin, CUB domain 0.0084
Further Details:      
 
Domain Number 8 Region: 530-594
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000236
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000040374   Gene: ENSRNOG00000009350   Transcript: ENSRNOT00000048543
Sequence length 992
Comment pep:known chromosome:Rnor_5.0:10:66710425:66759039:1 gene:ENSRNOG00000009350 transcript:ENSRNOT00000048543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAALLLLPSLLALLAHGLSSEAPITGEGQATGIREMDGELTAAPTPEQSDRGVHFVTT
APTLKLLNHHPLLEEFLQEGLEGREEAPRPALPFQPDSPTPFTPSPLPRLTNQDNRPVFT
SPTPAVAAAPTQPHSRKKPWNPESEPPELYITSPLPPGPSMAVPTLHPEDRPSTTPPSQA
WTPTQEGPGDMGRPWVPEIMSKTTGLGIEGTIATSTASGDDEETTTTTIITTVTTIQPPG
PCSWNFSGPEGSLDSPAVPSVPSDVGLDCLYYISVYPGYGVEIKVKNISLQEGETITVEG
LGGPDPLPLANQSFLLRGQVIRSPTHQAAVRFQSLPLPAGPGTFHFHYQAYLLSCHFPRR
PAYGDVTVTSLHPGGSARFHCATGYQLKGARFLTCLNATQPFWDSQEPVCIAACGGVIRN
ATTGRIVSPGFPGNYSNNLTCHWLLEAPESQRLHLHFEKVSLAEDDDRLIIRNGNNVEAP
PVYDSYEVEYLPIEGLLSSGRHFFVEFSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGNF
SSSAPSYPVGTTVEFSCDPGYTLEQGSIIIECVDLRDPQWNETEPACRAVCSGEITDSAG
VVLSPNWPEPYGRGQDCIWGVHVEEDKRIMLDIRVLRIGSGDVLTFYDGDDLTARVLGQY
SGPRGHFKLFTSMADVTIQFQSDPGTSALGYQQGFVIHFFEVPRNDTCPELPEIPNGWKN
PSQPELVHGTVVTYQCYPGYQVVGSSILMCQWDLSWSEDLPSCQRVTSCHDPGDVEHSRR
LISSLKFPVGATVQYICDQGFVLTGSAILTCHDRQAGSPKWSDRAPKCLLEQFKPCHGLS
APENGARSPEKRLHPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASLDG
FYNGRSLDVAKAPATSSALDAAHMAAAIFLPLVAMVLLVGGVYLYFSRLQGKSPLQLPGT
HPRPYNRITVESAFDNPTYETGSLSFAGDERI
Download sequence
Identical sequences F1MA42
NP_001099224.2.100692 NP_001099224.2.4139 ENSRNOP00000040374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]