SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000040874 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000040874
Domain Number 1 Region: 78-164
Classification Level Classification E-value
Superfamily HMG-box 3.27e-32
Family HMG-box 0.00000625
Further Details:      
 
Domain Number 2 Region: 3-81
Classification Level Classification E-value
Superfamily HMG-box 9.43e-27
Family HMG-box 0.00000511
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000040874
Domain Number - Region: 179-214
Classification Level Classification E-value
Superfamily ARM repeat 0.00118
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000040874   Gene: ENSRNOG00000030351   Transcript: ENSRNOT00000045504
Sequence length 215
Comment pep:known chromosome:Rnor_5.0:1:250371993:250373468:-1 gene:ENSRNOG00000030351 transcript:ENSRNOT00000045504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEDDEEDEEDEEEEEEEEDEDEEEEDDDE
Download sequence
Identical sequences ENSRNOP00000040874 10116.ENSRNOP00000040874 ENSRNOP00000040874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]