SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000041451 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000041451
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily Globin-like 8.5e-48
Family Globins 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000041451   Gene: ENSRNOG00000045989   Transcript: ENSRNOT00000052292
Sequence length 142
Comment pep:known chromosome:Rnor_5.0:10:15472255:15473102:-1 gene:ENSRNOG00000045989 transcript:ENSRNOT00000052292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSEEDKNNIKKAWVKIGNHAAEIGAETIGRLFIVFPSSKTYFPHFNTSEGSDQVKAHG
KKVADALTNAASHLDDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLASHHPGDFTP
AMHASLDKFFASVSTVLTSKYR
Download sequence
Identical sequences Q63910
ENSRNOP00000041451 ENSRNOP00000041451 NP_001013875.1.100692 NP_001013875.1.4139 10116.ENSRNOP00000041451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]