SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000041453 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000041453
Domain Number 1 Region: 580-825
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.3e-80
Family Eukaryotic proteases 0.0000725
Further Details:      
 
Domain Number 2 Region: 89-217
Classification Level Classification E-value
Superfamily SEA domain 4.71e-23
Family SEA domain 0.0081
Further Details:      
 
Domain Number 3 Region: 232-351
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000183
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 4 Region: 467-505
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 361-461
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000589
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 6 Region: 543-582
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000118
Family LDL receptor-like module 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000041453
Domain Number - Region: 503-539
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000196
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000041453   Gene: ENSRNOG00000002145   Transcript: ENSRNOT00000045521
Sequence length 829
Comment pep:known chromosome:Rnor_5.0:11:64202921:64238347:1 gene:ENSRNOG00000002145 transcript:ENSRNOT00000045521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKEKSDPSCKSSDLKISNISIQVVSVPGKLPGRRLPRKPIGKARPRKQPKKRAPFWNVQ
NKIILFTVFLFILAVTAWTLLWLYISKTDSKDAFYFVGMFRITNIEFLPEYRQKESREFL
SMAKTVQQVVNLVYTTSAFSKFYKQSVVADVSSNNKGGLLVHFWIVFVMPHAKGHIFCEE
CVAAILKDSIQTSITNRTSVGTLQGLAVDMDSVVLNAGLRSDYSSAVGSDNGCSQYFYAD
HLTLRYPLEISATSGQLMCHFKLVAIVGYLIRLSIESIQLEADNCITDSLTVYDSLLPIR
SAILYRICEPTRTLMSFVSTNNLMLVTLKSPYVRRLAGIRAYFEVIPEQKCENTILVKEI
NSFEGKISSPYYPSYYPPKCKCNWTFQTSLSTLGIALKFHNYSITKKSMKGCEHGWWEIN
EHMYCGSYMDHETIFRVPSPLVHIQLQCSSRLSDKPLLVEYGSYNISQPCPAGSFRCSSG
LCVPQAQRCDGVNDCFDESDELFCVTAKPACNTSIFRQHGPLVCDGFQDCEDGQDEQNCT
RSIPCTNRTFKCGNDICFRKQNAQCDGIVDCPDRSDEEGCGCSRSSPFLHRVVGGSDSQE
GTWPWQVSLHFVGSAHCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFV
SPVRRIVVHEYYNSQTFDYDIALLQLSIAWPETLRQLIQPICIPPVGQRVRSGEKCWVTG
WGRRHEADSKGSPILQQAEVELIDQTVCVSTYGIITSRMLCAGVMSGKSDACKGDSGGPL
SCRRKSDGKWILTGIVSWGYGCGRPNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences R9PXY0
ENSRNOP00000041453 NP_001099352.2.100692 NP_001099352.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]