SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000042615 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000042615
Domain Number 1 Region: 599-858
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.77e-89
Family Eukaryotic proteases 0.000000114
Further Details:      
 
Domain Number 2 Region: 180-338
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.23e-32
Family MAM domain 0.0032
Further Details:      
 
Domain Number 3 Region: 366-469
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-29
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 4 Region: 67-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-17
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 5 Region: 509-610
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000249
Family Scavenger receptor cysteine-rich (SRCR) domain 0.01
Further Details:      
 
Domain Number 6 Region: 475-514
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 7 Region: 17-54
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000017
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000042615   Gene: ENSRNOG00000001916   Transcript: ENSRNOT00000051213
Sequence length 859
Comment pep:known chromosome:Rnor_5.0:11:21207441:21331294:-1 gene:ENSRNOG00000001916 transcript:ENSRNOT00000051213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEFSIVIVSPTSGNVSVECQPGSRPCANAWDCVATDLFCDGEVNCPDGADEDTGLCATA
CDGRFLLTGDSGVFQANRYPRPDESGVVCRWIIRVNQGLSVRMSFGKFISHYTDVLDIYE
GIGPSKILRGSFWETDPGTIRIFSNQVTVTFLIKSDEYDYIGFNATYSTFNSSEINNYEK
INCTFDDGFCFWTQDLDDDNEWERNQMARFPCYTGPFSDHTFGNESGFYISTPAEQAWKS
ERVGLSSLSLGFTSEPVCLHFWYYMCCENVYNLNIHVSSTETTDKIVFQRQGNYGRNWNY
GQVTLNETVEFKVVFNAFRNRGCSTIALDDISLTNGICSESPYPEPTLVPTPPPEHPTDC
GGPFELWEPNTTFSSPNFPDNYPNQAFCIWNLNAQSGKNIQLHFQEFDLENINDVVEVRD
GVKFDSLLLAVYTGRGPVKDLFSTTNRMTVIFDTDMKNGGKGFKANFTSGYYLGIPQPCQ
DDEFQCKDGNCIPMGNLCDSYQHCSDGSDEAHCVRFLNGTQSNNGLVQFNIHNIWHIACA
EPWTTQISNEVCHLLGLGSANSSMPILSTGGGPFVRLNEAPNGSLILTPSLQCSQDSLIL
LQCNHKSCGEKMVTQKVGPKIVGGSDTQAGAWPWVVALYYRDRSGDRLLCGASLVSSDWL
VSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQVVRRVVDRIVINPHYDKRRKVNDIAMM
HLEFKVNYTDYIQPICLPEENQTFTPGRMCSIAGWGYNKINGSTVDVLKEADVPLVSNEK
CQQQLPEYDITESMLCAGYEEGGTDSCQGDSGGPLMCQENNRWFLVGVTSFGVQCALPNH
PGVYARVSQFIEWIHSFLH
Download sequence
Identical sequences D4A911
ENSRNOP00000042615 ENSRNOP00000042615 10116.ENSRNOP00000042615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]