SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000043674 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000043674
Domain Number 1 Region: 4-175
Classification Level Classification E-value
Superfamily Ferritin-like 3.12e-59
Family Ferritin 0.00000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000043674   Gene: ENSRNOG00000045529   Transcript: ENSRNOT00000041781
Sequence length 176
Comment pep:novel chromosome:Rnor_5.0:X:34506000:34506828:-1 gene:ENSRNOG00000045529 transcript:ENSRNOT00000041781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEASSQVRQNYDRCCEEAVNTHIRLLLQASYSYLSMAFYFDRDDVALENFKRFFLSKSH
DCKASVEMFVFMQNKRGGHVFLPSIAKPDRKSWQGGFRAMECAFRMEMTINQSLLNLHEL
AKGKGDAHLCNFLGQHCLDQQVHVLKKIGGYLTNLRQMGAPEQALAEYLFDKLSLS
Download sequence
Identical sequences D3ZIZ8
ENSRNOP00000043674 10116.ENSRNOP00000043674 XP_001072248.1.4139 XP_228941.1.100692 ENSRNOP00000043674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]