SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000043777 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000043777
Domain Number 1 Region: 83-158
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-17
Family Translational machinery components 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000043777   Gene: ENSRNOG00000033314   Transcript: ENSRNOT00000050867
Sequence length 192
Comment pep:novel chromosome:Rnor_5.0:13:75340910:75341661:-1 gene:ENSRNOG00000033314 transcript:ENSRNOT00000050867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSDQGHGARGVKTEDKEWIFITTMMGCLVKDMKIKSLEETYLFSLSIKESEIIDFFLGAS
LQDEVLTIRPQKQTRAGQRTRGKVTGRCGSMLVYLIPSPRGTGIVSASVPKKLLLMSVTD
DCYNSARGCTATLGNFAKASFDAISKTYSYLTADLWKETVFTKSPYQEFTHHLVTITRVS
VQRTQALAVATT
Download sequence
Identical sequences ENSRNOP00000043777 10116.ENSRNOP00000043777 ENSRNOP00000043777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]