SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000043804 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000043804
Domain Number 1 Region: 284-477
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000427
Further Details:      
 
Domain Number 2 Region: 88-209
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-21
Family Pleckstrin-homology domain (PH domain) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000043804   Gene: ENSRNOG00000031168   Transcript: ENSRNOT00000049884
Sequence length 482
Comment pep:known chromosome:Rnor_5.0:3:33831452:34442266:1 gene:ENSRNOG00000031168 transcript:ENSRNOT00000049884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKRTSCSVQTSTNCDNSLETLNSAHQATGAVQMRIKNANSHPDRQSQTKSMILTDAGKV
TEPISRHRRNHSQHVLKDVIPPLEHPMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSGR
KLEFYKDPKQQALPNVKPRPNAESVDLCGAHIEWAAKDKSSKKSVFQITTASGNEFLLQS
DIDFLILDWFHAIKNAIDRLPKNPSFGSLELFSFQRSSSSEQPSHCHIDRKEQKPENRKS
FMFRLHHSVSDTSDKNRVKSRLKKFISRRPSLKTLQEKGIIKDQIFGSHLHTVCEREHST
VPWFVKQCIEAVEKRGLEVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTG
ALKMFFRELSEPLFPYSFFERFVEAIKKQDSDAKIETMKSLVKSLPPPNHDTMKILFGHL
TKIVAKAAQNLMSTQSLGIVFGPTLLRAENESGNVAVHMVYQNQVAEFMLTEYDKIFSSE
ED
Download sequence
Identical sequences Q6AYC5
NP_001013939.1.100692 NP_001013939.1.4139 ENSRNOP00000043804 ENSRNOP00000043804 10116.ENSRNOP00000043804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]