SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000044081 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000044081
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 1.66e-47
Family Globins 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000044081   Gene: ENSRNOG00000047321   Transcript: ENSRNOT00000048977
Sequence length 142
Comment pep:known chromosome:Rnor_5.0:10:15484461:15485305:-1 gene:ENSRNOG00000047321 transcript:ENSRNOT00000048977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSAADKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG
KKVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP
AMHASLDKFLASVSTVLTSKYR
Download sequence
Identical sequences A0A0G2JSV6
NP_001007723.1.100692 NP_001007723.1.4139 ENSRNOP00000044081 10116.ENSRNOP00000044081 ENSRNOP00000044081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]