SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000044233 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000044233
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Globin-like 1.43e-47
Family Globins 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000044233   Gene: ENSRNOG00000029886   Transcript: ENSRNOT00000051483
Sequence length 142
Comment pep:known chromosome:Rnor_5.0:10:15497886:15498744:-1 gene:ENSRNOG00000029886 transcript:ENSRNOT00000051483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHIDVSPGSAQVKAHG
KKVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACHHPGDFTP
AMHASLDKFLASVSTVLTSKYR
Download sequence
Identical sequences B1H216 P01946
ENSRNOP00000044233 10116.ENSRNOP00000044233 ENSRNOP00000044233 NP_037228.1.100692 NP_037228.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]