SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000044467 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000044467
Domain Number 1 Region: 294-576
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.49e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000102
Further Details:      
 
Domain Number 2 Region: 117-293
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.41e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000853
Further Details:      
 
Domain Number 3 Region: 578-683
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.57e-28
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 4 Region: 55-115
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000000142
Family TGS domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000044467   Gene: ENSRNOG00000019023   Transcript: ENSRNOT00000051910
Sequence length 695
Comment pep:known chromosome:Rnor_5.0:2:83279780:83298533:1 gene:ENSRNOG00000019023 transcript:ENSRNOT00000051910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEKASSPSGKMDGEKPLNPWPEYINTRLDMYHKLKAEHDSILAEKAAKDSKPIKVTLP
DGKQVDAESWKTTPYQIACGISQGLADNTVVAKVNKVVWDLDRPLETDCTLELLKFEDEE
AQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLETLCKK
IIKEKQTFERLEVKKETLLEMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVRH
TGKIKTLKIHKNSSTYWEGKADMETLQRIYGISFPDPKLLKEWEKFQEEAKNRDHRKIGR
DQELYFFHELSPGSCFFLPKGAYIYNTLMEFIRSEYRKRGFQEVVTPNIFNSRLWMTSGH
WQHYSENMFSFEVEKEQFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSGA
LTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPEKFLGD
IEIWNQAEKQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQLP
IRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVGP
TCDEYAQKVRQEFHDAKFMVDIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKASGTVNI
RTRDNKVHGERTVGETVERLQQLKQLRSKQAEEEF
Download sequence
Identical sequences Q5XHY5
NP_001006977.1.100692 NP_001006977.1.4139 ENSRNOP00000044467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]