SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000044482 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000044482
Domain Number - Region: 53-107
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.00742
Family D-ribulose-5-phosphate 3-epimerase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000044482   Gene: ENSRNOG00000033015   Transcript: ENSRNOT00000040657
Sequence length 136
Comment pep:known chromosome:Rnor_5.0:18:51646959:51675579:1 gene:ENSRNOG00000033015 transcript:ENSRNOT00000040657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHGFSVMMPSLLLLQKEKFTFEVGKGTDLQQAAFRVHFSISLQKRADLWEISTEHTITS
YNKIKHKPSYQGWFLLLWSSERSIKWPLDQCDFVSVMSIQPGLCGYIRLKLAEHREKEFL
LQATSEYKEGLSFEQV
Download sequence
Identical sequences Q7TPK8
10116.ENSRNOP00000044482 ENSRNOP00000044482 ENSRNOP00000044482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]