SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000044548 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000044548
Domain Number 1 Region: 306-604
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.49e-83
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000239
Further Details:      
 
Domain Number 2 Region: 127-305
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.19e-43
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00081
Further Details:      
 
Domain Number 3 Region: 609-714
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.81e-22
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 
Domain Number 4 Region: 66-127
Classification Level Classification E-value
Superfamily TGS-like 0.000000000000172
Family TGS domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000044548   Gene: ENSRNOG00000027726   Transcript: ENSRNOT00000044500
Sequence length 723
Comment pep:known chromosome:Rnor_5.0:2:217350915:217368084:-1 gene:ENSRNOG00000027726 transcript:ENSRNOT00000044500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLCLRWRRLGFPLPGFRRCELHTVREAPIPTPPHWLAERFGLFEELWTAQVKRLASMTQ
KKARTIKISLPEGQKVDAVAWNTTPYQLAQQISSTLADTAVAAEVNGELYDLDRPLETDC
HLRFLTFDSPEGKAVFWRSSAHVLGAAAEQHLGAVLCRGPSTESGFYLDFFLGKERTVRS
TELPTLERICQEIITAAQPFRRLEASRGQLRQLFKDNHFKLHVIEEKVTGTTATVYGCGM
SVDLCQGPHLRHTGQIGALKLLTNSSALWRSSEAPETLQRVSGISFPKAELLRNWEARRE
EAELRDHRRIGKEQELFFFHELSPGSCFFLPRGTRIYNALVAFIRAEYARRGFSEVKTPT
LFSTKLWEQSGHWEHYRAHMFSLKPPGTDGVDSSQSGHPARCPKDTLALKPMNCPAHCLM
FAHRPRSWRELPVRLADFGVLHRAEASGSLGGLTRLWRFQQDDAHIFCAPSQLEAEIRGC
LDFLRSVYSVLGFSFHLALSTRPPGFLGEPHLWDQAEKVLQQALEEFGEPWNLNPGDGAF
YGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGPAGAPECPVLIHRAVLGSVERL
LGVLAESCGGRWPLWLSPFQVVVIPVRTEQEDYARQVQQCLQAAGLVSDLDADCGLTLSR
RVRRAQLAHYNFQFVVGQREQSQMSVNVRTRDNRQLGERGLAESVQRLLELQDARVPNAE
ELF
Download sequence
Identical sequences Q68FW7
NP_001014062.1.100692 NP_001014062.1.4139 XP_008759530.1.100692 ENSRNOP00000044548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]