SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000044751 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000044751
Domain Number 1 Region: 549-736
Classification Level Classification E-value
Superfamily Sec7 domain 1.1e-64
Family Sec7 domain 0.00000725
Further Details:      
 
Domain Number 2 Region: 752-883
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000116
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000044751   Gene: ENSRNOG00000003466   Transcript: ENSRNOT00000050926
Sequence length 949
Comment pep:known chromosome:Rnor_5.0:X:64287625:64332621:-1 gene:ENSRNOG00000003466 transcript:ENSRNOT00000050926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPWKSSRSTASHTLHQYCCPTQVLDSMKLTPSGRLAESSVEGDAPGSDLSTAVDSPGS
QPPYRLSQLPPTSSHMGGPPAGVGLPWSQRARLQPASVALRKQEEEEIKRSKALSDSYEL
STDLQDKKVEMLERKYGGSFLSRRAARTIQTAFRQYRMNKNFERLRSSASESRMSRRIIL
SNMRMQFSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGLPYGGSCGGGIDGGGS
SVTTSGEFSNDITELEDSFSKQVKSLAESIDEALNCHPSGPMSEEPGSAQLEKRESKEQQ
EDSSATSFSDLPLYLDDPVPPPSPERLPSTEPPPQGRPEFWAPAPLPPVPPPMPPGTRED
GSREEGTRRGPGCLECRDFRLRAAHLPLLTIEPPSDSSVDLSDRSDRGSVHRQLVYEADG
CSPHGTLKHKGPPGRAPIPHRHYPAPEGPAPAPPGPLPPAPNSGTGPSGVAGGRRLGKCE
AAGENSDGGDNESLESSSNSNETINCSSGSSSRDSLREPPATGLCKQTYQRETRHSWDSP
AFNNDVVQRRHYRIGLNLFNKKPEKGIQYLIERGFLSDTPVGVAHFILERKGLSRQMIGE
FLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKFQSHIRVQGEAQKVERLIEAFSQRYC
VCNPALVRQFRNPDTIFILAFAIILLNTDMYSPSVKAERKMKLDDFIKNLRGVDNGEDIP
RDLLVGIYQRIQGRELRTNDDHVSQVQAVERMIVGKKPVLSLPHRRLVCCCQLYEVPDPN
RPQRLGLHQREVFLFNDLLVVTKIFQKKKILVTYSFRQSFPLVEMHMQLFQNSYYQFGIK
LLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIAEVQEMEKYRVESELEKQKGMMRPN
ASQPGGAKDSVNGTLARSSLEDTYGAGDGLKRGALSSSLRDLSDAGVCY
Download sequence
Identical sequences A0A0G2JZX5
NP_001264315.1.100692 NP_001264315.1.4139 ENSRNOP00000044751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]