SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000045430 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000045430
Domain Number 1 Region: 158-264
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-31
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 2 Region: 53-145
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-18
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000045430   Gene: ENSRNOG00000029945   Transcript: ENSRNOT00000050519
Sequence length 607
Comment pep:known chromosome:Rnor_5.0:1:208914610:208927737:-1 gene:ENSRNOG00000029945 transcript:ENSRNOT00000050519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTGRLFIWAILAVSCRAQLNSTAAEGRPRCTASLGGANLGETHKALILNLNADENCTW
TIERPENRSIRIIFSHIQLDPDSRCENESIKVFDGRSTSGPLLGEACSKNDFVPVFESSA
NSLTFQIVTDWTRVQRSVFIFYYFFSSGTTIPNCGGYLQTLEGSFSSPNYPRPHPELAYC
VWHIQVEKGYKINLNFTELFLEMDEYCRFDFIAVYDGPSTTSGLLKQVCGRGTPTFESSS
DAMTVVLSTDYANSYRGFFASYASTYVQEVNTTSLSCASDKMRVIISKSYLQSLNYHESN
LQLNDPTCRPSVSNVVEFSIPLHECGTIKKIEDHTISYTNIITFTQSPESAVITRKRHLQ
IVVTCEMEYNSTVEILYITEDDVIQNQSVLGKYNTSMALYESGSFENLIQESPYYVDLNQ
TLFVQATLHTSDPSLVVFLDTCRASPTSDFASPTYDLISSGCSRDETCKVYPLFGHYGRF
QFNAFKFLRHLSSVYLKCKILICDTSDHTSRCNQGCVSRRKRDIPSYKWKTDSVIGPIRL
KRDRLVNGDSGLLPQTHEAEISKQPLSHLHLFSFMVLALNVVIVVTATVRHFLNRWKDHG
YQKLQVY
Download sequence
Identical sequences F1M8L3
ENSRNOP00000045430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]