SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000045671 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000045671
Domain Number - Region: 145-182
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00209
Family Frizzled cysteine-rich domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000045671   Gene: ENSRNOG00000031435   Transcript: ENSRNOT00000050826
Sequence length 198
Comment pep:known chromosome:Rnor_5.0:15:106077528:106254924:1 gene:ENSRNOG00000031435 transcript:ENSRNOT00000050826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWA
RLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLT
VGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDT
EWNLFIGKRHSPGPVTET
Download sequence
Identical sequences ENSRNOP00000045671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]