SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000045726 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000045726
Domain Number 1 Region: 180-252
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000792
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 242-302
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000283
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 56-118
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000607
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 4 Region: 117-178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000668
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000045726   Gene: ENSRNOG00000003562   Transcript: ENSRNOT00000052407
Sequence length 490
Comment pep:known chromosome:Rnor_5.0:13:106115286:106237584:1 gene:ENSRNOG00000003562 transcript:ENSRNOT00000052407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHGMNPSNGDGFLEQQLQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLNVCADP
GVPENGFRTPSGGVFFESSVARFHCQDGFKLKGSSKRLCVKRLNGTLGWIPSDKPLCIQE
DCRIPRIEDAEIHNKTYRHGDKLIINCHEGFKIRYPDLYNMVSLCRDDGTWDNLPICQGC
LRPLASSNGYVNISEFQTSFPVGTVIAYRCFPGFKLEGSEYLECLHNLIWSSSPPRCLAL
EVCPLPPMVSHGDFICHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV
YCIKSEQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAHFPPRGPPRSS
SSDPDFVVVDGVPVMLPTYDEAVNGSSSALGPGYLASVGQGCPLPVDDQSPPAYPGSGDT
DTGPGESETCDSTSGSSEMLQSLYSPPMCQGGSRPAPDTPDTISSTAGEVASTSPGIDIA
DEIPLMEEDP
Download sequence
Identical sequences D4A231
10116.ENSRNOP00000045726 ENSRNOP00000045726 ENSRNOP00000045726 NP_001099452.1.100692 NP_001099452.1.4139 RnR276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]