SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000045832 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000045832
Domain Number 1 Region: 260-521
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-87
Family Protein kinases, catalytic subunit 0.000000000204
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000045832
Domain Number - Region: 79-181
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0536
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000045832   Gene: ENSRNOG00000029784   Transcript: ENSRNOT00000049321
Sequence length 544
Comment pep:known chromosome:Rnor_5.0:1:168974734:169089649:1 gene:ENSRNOG00000029784 transcript:ENSRNOT00000049321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNNGLDVQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILA
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDD
DDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEK
QKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQM
NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCM
DEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR
STMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGT
PELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
KNNH
Download sequence
Identical sequences P35465
ENSRNOP00000045832 ENSRNOP00000045832 NP_058894.1.100692 NP_058894.1.4139 XP_006229814.1.100692 XP_006229815.1.100692 XP_006229816.1.100692 10116.ENSRNOP00000045832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]