SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000047177 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000047177
Domain Number 1 Region: 509-843
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.58e-48
Family Tandem AAA-ATPase domain 0.00031
Further Details:      
 
Domain Number 2 Region: 375-412
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000209
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000047177   Gene: ENSRNOG00000032446   Transcript: ENSRNOT00000045135
Sequence length 1216
Comment pep:known chromosome:Rnor_5.0:7:117753871:117761035:-1 gene:ENSRNOG00000032446 transcript:ENSRNOT00000045135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLATVRARLQDWERAFVRLHGRRPAKEDVEAAPEETRALYREYRNLKQAVSQADDGHR
VQKQSLAKAAEEEQEPSCWGSHLNRAATQNTQSIPKQSPLSSIQDYGKRLKANLKNTLQG
GPTLSRKLQHQKRSLSIVPTSRPPGPRTESPCPEQANDALPQVPVPQPRQGQLQKLQSSL
SLRLSSLDPGWLERCQNRVSDPLEVPGACGLDLSAKESQPQMSGKVNVISPDILSEVSSQ
SPQALAQQPAQVLSQIPKSSNSKDRKRKRNEKGEDFAQAQPSSQAGPLSEGAGATAHGQG
PPGEPTQVTVPQHRCSSNQARTENAKSAAHLPMSPRPASLDRGNYVRLNMKTKCFVRVGA
SRGRLLRKQVWKQKWKKKQEWFGKSGPRATVKDTCFRCGQFGHWASQCSQPGSTLTIQPK
GDRNDKHPISTLGGVAQKTGTTSCNHSGEETEPAGPVLPVPHCPTPVLPLYPPGPLGQVA
DTPAEVFQVLEQLGHHTFRPGQERAVMRILSGISTLLVLPTGAGKSLCYQLPALLYAKRS
PCLTLVVSPLLSLMDDQVSDLPSCLKAACLHSGMTKKQRESVLKKVRAAQVHVLIVSPEA
LVGCGAKGPANLPPAAQLPPVAFACIDEVHCLSQWSHNFRPCYLRVCKVLREHMGVRCFL
GLTATATRSTARDVAQHLGIAEELEVSGSASIPANLHLSVSMDRDSDQALVTLLQGDRFR
TLDSIIIYCARRKDTERVAALLRTCLSTVRDSKPRGRGPETLAEAYHAGMCSQERKRVQQ
AFMQGHLRMVVATVAFGMGLDRPDVRAVLHLGLPPSFESYVQAIGRAGRDGKPAHCHLFL
HPQGEDLWELSRHVHADSTDFLAVKKLVQRVFPACSCAQRPMSPLEEVKEHSGQQTYPVL
GLACRGHKRALPVQSTVLALDMKEEAIETLLCYLELHPRHWLELLPYTYAHCHLRCPGGS
AQLQALVHRCPPLAACWAKWPPKDTSQGSSALEFDVVELADSMGWELASVRQALHQLKWD
PEPKKGAPQGTGVLVEFSELAFHLHSRGDLTDEEKDQICDFLYSRVQAREHKALAHLHQM
SKAFQSVAFPSCGPCLEQSDEGHSNRVKTLVSYYFEEEEEEEEEETMKDTQDPKPGQTQL
QDWEDQVRRDVHQLLSLRPEEKFSGRAVARIFHGIASPCYPAQVFGQDRRFWRKYLHLDF
HALMHLATEELLLRGR
Download sequence
Identical sequences D4A5W5
ENSRNOP00000047177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]