SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000047206 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000047206
Domain Number 1 Region: 275-428
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.47e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000724
Further Details:      
 
Domain Number 2 Region: 431-596
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000197
Further Details:      
 
Domain Number 3 Region: 148-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-33
Family Spermadhesin, CUB domain 0.0000184
Further Details:      
 
Domain Number 4 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 5 Region: 642-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-25
Family MAM domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000047206   Gene: ENSRNOG00000031232   Transcript: ENSRNOT00000042562
Sequence length 925
Comment pep:known chromosome:Rnor_5.0:9:69307750:69419329:1 gene:ENSRNOG00000031232 transcript:ENSRNOT00000042562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMFPLTWIFLALYFSGHKVRSQQDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWVVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSVL
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPRMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSKLRS
STGILSLTFHTDMAVAKDGFSARYYLVHQEPPENFQCNAPLGMESGRIANEQISASSTFS
DGRWTPQQSRLHGDDNGWTPNVDSNKEYLQVDLRFLTMLTAIATQGAISRETQKGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDATELVLNKLHTPLLTRFIRIRPQTWHLGIAL
RLELFGCRVTDAPCSNMLGMLSGLIADTQISASSTREYLWSPSAARLVSSRSGWFPRNPQ
AQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAMEARAFVRKFKVSYSLNGKDWEYIQD
PRTQQPKLFEGNMHYDTPDIRRFEPVPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPMDEDATECGENCSFEDDKDLQLPSGFNCNFDFPEETCGWMYD
RAKWLQSTWISSANPNDRTFPDDKNFLKLQSDGGREGQFGRLISPPVHLPRSPVCMEFQY
QAMGGHGVALQVVREARQESKLLWVIREDQGSEWKHGRIILPSYDMEYQIVFEGVIGKGR
SGEISIDDIRISTDVPLENCMEPISAFAVDIPEIHGGEGYEDEIDDDYEGDWNNSSSTSG
AGSPSSGKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTLE
NYNFELYDGLKHKVKINHQKCCSEA
Download sequence
Identical sequences O35276
ENSRNOP00000047206 NP_110496.1.100692 NP_110496.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]