SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000048427 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000048427
Domain Number 1 Region: 185-501
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.36e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0065
Further Details:      
 
Domain Number 2 Region: 71-168
Classification Level Classification E-value
Superfamily ISP domain 8.51e-26
Family Rieske iron-sulfur protein (ISP) 0.027
Further Details:      
 
Domain Number 3 Region: 505-583
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 5.77e-21
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000048427   Gene: ENSRNOG00000037957   Transcript: ENSRNOT00000040978
Sequence length 604
Comment pep:known chromosome:Rnor_5.0:11:90417093:90431999:1 gene:ENSRNOG00000037957 transcript:ENSRNOT00000040978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRGYQGNGTARHFHAEERLPTPQP
YPSPQDCVEATVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGV
LSRGRVRCPWHGACFNIGTGDLEDFPGLDSLHKFQVKIEKEKVTVRASKQALQLQRRTKV
MAKCISPSAGHSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRAKLSKS
LDAQPEQLALRPKEFFRAYGIEMLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSSP
KTLTCKGKDIENVFTIRTPEDANRVLRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSVV
ELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRAQEGKLQEVVLKSSKVLRAD
VCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNIPGVFAAGDAVTFPLAWRNNRKV
NIPHWQMAHAQGRVAAQNMLAQEAEINTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLE
ELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVELFMLHSKTGDMSWLT
GKGS
Download sequence
Identical sequences D3ZF03
10116.ENSRNOP00000048427 ENSRNOP00000048427 NP_001013999.2.100692 NP_001013999.2.4139 ENSRNOP00000048427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]