SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000048657 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000048657
Domain Number 1 Region: 250-559
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.69e-116
Family PDEase 0.0000000778
Further Details:      
 
Domain Number 2 Region: 27-229
Classification Level Classification E-value
Superfamily GAF domain-like 8.83e-43
Family GAF domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000048657   Gene: ENSRNOG00000024457   Transcript: ENSRNOT00000045862
Sequence length 580
Comment pep:known chromosome:Rnor_5.0:3:69363100:69603706:-1 gene:ENSRNOG00000024457 transcript:ENSRNOT00000045862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SWVMQMYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQ
TLLKCERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESVEKSSYSDWLINNSI
AELVASTGLPVNVSDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLD
GKPFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKF
KAANIPLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVR
KNYRMVLYHNWRHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAF
QAKSDSALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILAT
DLTLYFERRTEFFELVSKGAYDWSITSHRDVFRSMLMTACDLGAVTKPWEISRQVAELVT
SEFFEQGDRERSELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNAKLKPML
DSVAANRRKWEELHQKRLQVSAASPVPSSPSPAVAGEDRL
Download sequence
Identical sequences ENSRNOP00000048657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]