SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000048924 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000048924
Domain Number 1 Region: 114-175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 261-319
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000514
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 77-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000136
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000048924   Gene: ENSRNOG00000039666   Transcript: ENSRNOT00000045753
Sequence length 464
Comment pep:known chromosome:Rnor_5.0:X:14932359:15003055:-1 gene:ENSRNOG00000039666 transcript:ENSRNOT00000045753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPGLRPTLLLPQVLLLLLALLHVPPSQGFPGSGDSPLEDDGVWSSHSLYKDTPWCSPI
KVKYGDVYCRAPPGGYYKTALGTRCDIRCRKGYELHGSSQLVCQSNRRWSDKVICKQKRC
PTLTMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPP
RIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILRGLPPGSNFPEGDHKIEYT
VYDRAENKGTCKFRVKVRVRRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSP
ARVCQSNLAWSGTEPSCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLG
MLQQAQCGLDLRHITVVELVGVFPTLIGRIRAKIMPPALALQLRLLLRIPLYSFSMVLVD
KHGMDKERYVSLVTPMALFNLIDTFPLRKEEMILQAEMGQSCNT
Download sequence
Identical sequences Q63769
10116.ENSRNOP00000048924 NP_071969.1.100692 NP_071969.1.4139 ENSRNOP00000048924 ENSRNOP00000043949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]