SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000049829 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000049829
Domain Number 1 Region: 7-100
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000369
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.019
Further Details:      
 
Domain Number 2 Region: 308-603
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000411
Family Mo25 protein 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000049829   Gene: ENSRNOG00000031719   Transcript: ENSRNOT00000046065
Sequence length 788
Comment pep:novel chromosome:Rnor_5.0:X:59750792:59753158:1 gene:ENSRNOG00000031719 transcript:ENSRNOT00000046065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDKLHSVKVFVLVEDEQWKIIGTGQISSKYIERLQGVCLLVHSESDGSQIMECKIYPNV
PYHKQRGEIIVWSEAKNHGMAIYFQEPSGCQEIWEDICQVQGKDPSVEITQEVTDDLETF
ADLLPIGNLFEMPNCELNTLEHIADLFTFVDKTPNHRERMAMVLEKGSYIKKLLQLFNTC
EKLKNMEALHFLNNIIKGILFLDDTRLLNIMFSDEFFMDVVGCLEYDPALDQPKQYREFL
LQNAKFREIMPITNSQLRQKIQETYRMQYVYDIVLPAPSIFDSNLLSDLNAMIIFNKSEI
ITMLQDDENFLLEALSQLKDNTVGYERWYELLLFFKEFCIFAKALENQEKDELLKTLIKL
GIMSALKVLVHMHDYQIQKAALDIFPYLVEYNPCLVREYLLEEAQDSEDNDELLINVMIK
QMIYDPDPEFSKDIILPAVLRALLDPENMHVTANGCEKAKFLNFFYARCMGNLIAPILST
TVENDTDDNMVNICPNYQNAQLLGVILEILTFCVQYHSTYMKNYILNNNLLSRILMLMSS
KHTFLILCAVRFMRKIISLKDEIYNLYIIKKNLFEPIVNAFMHNGTRYNMLNSAIIELFE
FIRQENIKSLIANIVENFFIAFESIEYVQTFKGLKTKYEEEKKRESGIRRNLYNVIYQKI
YCRHIKVMELKVKADICCREITEEEGAILPMGKEFPSHYDIIMKIKETNENENVIEHPKS
NETSKCSSSCGDASSNKMSMVHCSSLVPLVDYPYDTDGESDDDPYGNDENDDEDKDNEPL
SKRPNLSS
Download sequence
Identical sequences ENSRNOP00000049829 XP_006227414.1.4139 XP_006257065.1.100692 XP_017443720.1.4139 XP_017457795.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]