SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000049976 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000049976
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Globin-like 1.27e-38
Family Globins 0.00000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000049976   Gene: ENSRNOG00000048992   Transcript: ENSRNOT00000041830
Sequence length 111
Comment pep:novel chromosome:Rnor_5.0:1:176575572:176576023:-1 gene:ENSRNOG00000048992 transcript:ENSRNOT00000041830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTDAEKATVNGLWGKVNPVEIGAESLASLLIVYPWTQRYFSKFGDLSSVSAIMGNPQ
VKAHGKKVINAFDDGLKHLDNLKGTFGSLSELHCDKLHVDPENFRVSLMGS
Download sequence
Identical sequences ENSRNOP00000049976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]