SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000050978 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000050978
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 7.69e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000048
Further Details:      
 
Domain Number 2 Region: 242-321
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 5.23e-31
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000050978   Gene: ENSRNOG00000031058   Transcript: ENSRNOT00000051439
Sequence length 355
Comment pep:known chromosome:Rnor_5.0:X:15938008:15946861:1 gene:ENSRNOG00000031058 transcript:ENSRNOT00000051439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGPVGGRSGGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATAVVQLYLALPPG
AEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFAGD
DCQVGLNFSDESEAQAFRALVQEKIQKRNQRQSGERRQLPLTPAPTNEERRGGLPPVPPH
PGGDHGGPSGGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPTDKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPPPPPPCRGGGGNPWSYGELSTASTPSAVRRPSGCPDACHAEEE
Download sequence
Identical sequences G3V9K5
NP_001101718.1.100692 NP_001101718.1.4139 ENSRNOP00000050978 ENSRNOP00000050978 10116.ENSRNOP00000050978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]