SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000051857 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000051857
Domain Number 1 Region: 38-121,313-383
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0000144
Family Tricorn protease domain 2 0.026
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000051857
Domain Number - Region: 553-608
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0207
Family Transglutaminase, two C-terminal domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000051857   Gene: ENSRNOG00000036699   Transcript: ENSRNOT00000054974
Sequence length 882
Comment pep:known chromosome:Rnor_5.0:10:109136955:109145928:-1 gene:ENSRNOG00000036699 transcript:ENSRNOT00000054974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGASSRVHYLSDFCCPLGGRAAGKPHVLRHDAEVFLSTGREFVYVYDQEGGLLTAVYQF
PDQVWHLQLLATRRALYVLCARTGIYCLSLDSLDRSGSQACEDKEDETHPYPVIHVDPDA
CVLPDAALCAFTVLDDVLVTLAQGPTQWKMQLFECPHAGEEPRPGGQVGEVQLSTCTPPG
GVPGEPTAPCFLPVLCCVFPPDSRAPHGHPQGCGCFMLEEALFGLLFGVDASLLQSPVVL
CGLPDGQLCCVALKALVTSELAPGDPKVLVKILHHLEEPVIFIGALRAEPQEEEEEEAVR
ELLPVENVHSDCLVALGHQGRTLAIRASWSESGNLVPELREYYLPGPVLCAACGRDGHMY
HSTPSDLCVVDLTRRDSTWNPEKPDGAIGSLPSTLCPASLNICSALALCVTARAPTGGTE
LLVLSSKGRLITCSLDLNPEAPVPTKMAVANAGQKIKELLLDIGDVSERVSFLKKAVDQR
NKAITSLNEAMNVSCALLSSQEGDRPISCTITTSWSRLELRDMLMATCTLDNSSSFSLDQ
GWTLCIQVLTSSSALDLDGTGSAFTYTIPVDRLGPGSRREVTLPLGPSESGVLDLPVTMS
CWLFYSLREVIGEALAPSDPLEVPYLEKLPLNLPKQEGVCLPLCKRTVDMLQCLRFPGVA
SHPAQAPSVPGPACDPVETFLKTCQGPGSEPTGAASLRAKYLPPSTASIRVSAGLLRAAL
EDGHSGFHLCSATLCWLLAENAAVDVLRAQALSSIQGIAPDGTDVNLIVHEVAVTDLSPA
GPIQAVEIQVESSSLANMCRAHHAIIRRIKTMVTEQAAQGSSPPDLRMQYLQQIHANHQE
LLREVQTLRDQLCTEDEVSSCSTAQKLLQIYKQLRNPSLVLL
Download sequence
Identical sequences D3ZX03
XP_008766711.1.100692 XP_008773876.1.4139 XP_017453245.1.100692 XP_017453246.1.100692 XP_017459703.1.4139 XP_017459704.1.4139 ENSRNOP00000051857 10116.ENSRNOP00000051857 ENSRNOP00000051857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]