SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000051870 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000051870
Domain Number 1 Region: 458-562
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000181
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000051870   Gene: ENSRNOG00000030537   Transcript: ENSRNOT00000054987
Sequence length 592
Comment pep:known_by_projection chromosome:Rnor_5.0:10:108086788:108110278:1 gene:ENSRNOG00000030537 transcript:ENSRNOT00000054987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPDTHCCSRADLRRRLPVLAWLPNYSLRWLRMDVIAGLSVGLTVIPQALAYAEVAGLPP
QYGLYSAFMGCFVYFVLGTSRDVTLGPTAIMSLLVSYYTFREPAYAVLLAFLSGCIQLAM
GLLHLGFLLDFISCPVIKGFTSAASITIGFGQVKNLLGLQNIPRQFFLQVYHTFLHIGET
RVGDAILGLVCMVLLLVLKLMREHIPPPHPEMPLGVKFSRGLVWTVTTARNALVVSFAAL
IAYAFEVTGSHPFILTGKIAQGLPPVRMPPFSVTTDNKTISFSEMVQDTTSGYLFVPLSA
LSNSVSTASLASQNNYRIDANQELLAIGLTNVLGSLVSSYPVTGSFGRTAVNAQTGVCTP
AGGLVTGVLVLLSLDYLTLLFYYIPKSALAAVIIMAVAPLFDVKIFRRLWLVQRLDLLPL
CVTFLLSFWEIQYGILAGTLVSLLILLHSVARPKTQVSEGQILVLQPASGLHFPAVDALR
EAMTKRALEASPPRSAVLECTHVSNIDYTVILGLGELLEDFQKKGVTLAFVGLQVPVLRT
LLAADLKGFQYFTTLEEAEKSLQQEPGTQPYSIREDTAPEHRSSLLKSPSGP
Download sequence
Identical sequences F1M067
ENSRNOP00000051870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]