SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052677 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052677
Domain Number 1 Region: 129-438
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.01e-107
Family Transglutaminase core 0.0000000577
Further Details:      
 
Domain Number 2 Region: 1-128
Classification Level Classification E-value
Superfamily E set domains 1.01e-33
Family Transglutaminase N-terminal domain 0.00031
Further Details:      
 
Domain Number 3 Region: 566-660
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.97e-23
Family Transglutaminase, two C-terminal domains 0.001
Further Details:      
 
Domain Number 4 Region: 453-554
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000133
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052677   Gene: ENSRNOG00000004320   Transcript: ENSRNOT00000055822
Sequence length 661
Comment pep:known chromosome:Rnor_5.0:8:131275399:131311091:1 gene:ENSRNOG00000004320 transcript:ENSRNOT00000055822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVVYSVNLEKKLNAAAHHTIEYQTQKLVLRRGQIFSLKVMLNRPLQSHDELKLIFNTGHN
MPFYTVELDPMTSYRSKGWQVKIAKQSGVEVVLNVISAADAVVGRYTMNVNEFDAGVFFL
LFNPWCSDDSVFMASEEDRAEYVLNDTGYMYMGFAKQIKEKPWTFGQFEKYILNCCFRLL
THLEPKEMQSPVLVSRAICTMMCAANNFGVLVGNWTGDYSNGTAPYVWASSVPILQQHYI
TRMPVRFGQCWVFSGVLTTALRAVGIPARSVTNFESAHDTEKNLRVDIYLDESGKTIPHL
TKDSVWNFHVWTDAWMKRQDLPQGHDGWQVLDSTPQEISEGQFRIGPSPVSAIRQGLVQI
MYDTTFVFTEVNGDKYIWLVKQNQEREKNVLIAVETASIGKNISTKMVGENRRQDITLHY
KFPEGSPEERKAMEKASGKRPDDKLNSRTLHISVLQNSVELGHPINLTIVLKRKTATPQN
VNISCSLDLQTYTGNKKTNLGVIQKTVQIQGQESEVSLSMDSSFYIYKLGMVDDEMVIKG
FIIAEIVDSGERVATDTTLCFLYSAFSVEMPSTSKVNQPLTITCNFKNTLPIPLTNIKFS
VESLGLNNMKSWEQETVPPGKTINFQIECTPVKTGPRKFIVKFISRQVKEVHAEKVVLIT
K
Download sequence
Identical sequences ENSRNOP00000052677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]