SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052803 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052803
Domain Number 1 Region: 1685-1876
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.7e-40
Family Laminin G-like module 0.00076
Further Details:      
 
Domain Number 2 Region: 1938-2139
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-38
Family Laminin G-like module 0.00074
Further Details:      
 
Domain Number 3 Region: 99-115,1442-1622
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-34
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 988-1082
Classification Level Classification E-value
Superfamily Immunoglobulin 2.36e-20
Family I set domains 0.0082
Further Details:      
 
Domain Number 5 Region: 1350-1437
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-19
Family I set domains 0.022
Further Details:      
 
Domain Number 6 Region: 886-979
Classification Level Classification E-value
Superfamily Immunoglobulin 7.1e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 7 Region: 1273-1359
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 8 Region: 412-498
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 9 Region: 136-228
Classification Level Classification E-value
Superfamily Immunoglobulin 3.71e-17
Family I set domains 0.024
Further Details:      
 
Domain Number 10 Region: 229-316
Classification Level Classification E-value
Superfamily Immunoglobulin 8.55e-17
Family I set domains 0.0000226
Further Details:      
 
Domain Number 11 Region: 607-694
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-16
Family I set domains 0.046
Further Details:      
 
Domain Number 12 Region: 1072-1160
Classification Level Classification E-value
Superfamily Immunoglobulin 2.03e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 13 Region: 509-595
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000332
Family I set domains 0.063
Further Details:      
 
Domain Number 14 Region: 1177-1268
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000103
Family I set domains 0.014
Further Details:      
 
Domain Number 15 Region: 322-409
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000254
Family I set domains 0.025
Further Details:      
 
Domain Number 16 Region: 704-789
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000279
Family V set domains (antibody variable domain-like) 0.069
Further Details:      
 
Domain Number 17 Region: 802-895
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000045
Family I set domains 0.059
Further Details:      
 
Domain Number 18 Region: 21-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000402
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 19 Region: 1880-1923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000664
Family EGF-type module 0.011
Further Details:      
 
Domain Number 20 Region: 80-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000812
Family Laminin-type module 0.073
Further Details:      
 
Domain Number 21 Region: 1620-1653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000199
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052803   Gene: ENSRNOG00000021437   Transcript: ENSRNOT00000055950
Sequence length 2165
Comment pep:known_by_projection chromosome:Rnor_5.0:5:159630654:159668805:1 gene:ENSRNOG00000021437 transcript:ENSRNOT00000055950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCAPGYTRTGSGLYLGQCELCECNGHSEVCHPETGACTGCQHNTVGEFCETCATGYYGDA
TAGTPEDCQPCACPLTNPENMFSRTCESLGAGGYRCTACEPGYTGQYCEQCAPGYEGNPN
VQGGRCQPLTKESLEVQIHPSRSVVPQGGPHSLRCQVNGSPPHYFYWSREDGRPLPSGAQ
QRHQGSELHFPSVQPSDAGVYICTCRNLIHTSNSRAELLVAEAPSKPITVTVEEQRSQSV
RPGADVTFICTAKSKSPAYTLVWTRLHNGKLPSRAMDFNGILTIRNVQPSDAGTYVCTGS
NMFAMDQGTATLHVQVSGTSTAPVASIHPPQLTVQPGQLAEFRCSATGNPTPTLEWIGGP
SGQLPTKAQIHNGILRLPAIEPSDQGQYLCRALSSAGQHVVRAMLQVHGGSGPRVQVSPE
RTQVHEGRTVRLYCRAAGVPSASITWRKEGGSLPFRHQAHGSRLRLHQMSVADSGEYVCR
ANNNIDAQETSIMISVSPNTNAPSASASPVPIRIESSSSHVAEGQTLDLNCVVPGQAHAQ
VTWHKRGGSLPAHHQAHGSRLRLYQVSPADSGEYVCRVLSSSGPLEASVLVSITASASNV
HVPGGVPPIRIETSSSQVAEGQTLDLTCVVPGQAHAQVTWHKRGGSLPAGHQVHGHILRL
NRVSPADSGEYSCQVTGSSGTLEASVLVTIEASQPSPIPAPGLAQPIYIESSSSHLAEGQ
TVDLNCVVPGQAHAQVTWHKRGSSLPARHQTHGSLLRLYHISPADSGEYVCQVAGSSHPE
HEASFKITVPASEGSSYRLRSPVISIEPPSSTVQQGQDASFKCLIHEGATPISLEWKTRN
QELEDNVHISPNGSIMTIVPGPATMEPICVASNVYGVAQSVVNLIVHGPPTVSVLPEGPV
HVKMGKDITLECVSSGEPRSSPRWTRLGIPVKLEPRMFGLMNSHAMLKIASVKPSDAGTY
VCQAQNALGTAQKQVELIVDTGTVAPGAPQVQVEEAELTLEAGHTATLHCSATGNPPPTI
HWSKLRAPLPWQHRIEGNTLVIPRVAQQDSGQYICNATNSAGHTEATVVLHVESHPYATI
IPEHTSVQPGKLVQLQCLAHGTPPLTYQWSRVGGILPEKAVARNQLLRLEPAGRADSGRY
RCQVSNKVGSAEAFAQVLVQGSSGDVPDTSTPVGSTPTVQVTPQQETKSIGASVEFHCAV
PNEHGTHLRWLKEGGQLPPGHSVQDGVLRIQNLDQSCQGTYICQAHGPWGQAQATAQLIV
QALPSVLINVRTSVHSVVVGHSVEFECLALGDPKPQVTWSKVGGRLRSGIVQSGSVIRIA
HVELADAGQYRCAATNAAGTTQSHVLLLVQALPQISTPPEVRVPAGSAAVFPCMASGYPT
PAITWSKVDGDLPPDSRLENNMLMLPSVRPEDAGTYVCTATNRQGKVKAFAYLQVPERVV
PYFTQTPYSFLPLPTIKDAYRKFEIKITFRPDSADGMLLYNGQKHTPGSPTNLANRQPDF
ISFGLVGGRPEFRFDAGSGMATIRHPTPLALGQFHTVTLLRSLTQGSMIVGNLAPVNGTS
QGKFQGLDLNEELYLGGYPDYRAIPKAGLSSGFVGCVRELRIQGEEIVFHDVNLTTHGIS
HCPTCQDRPCQNGGQCHDSESSSYTCVCPAGFTAAVSIRKPCTATQACGPDATCVNRPDG
RGYNCRCHLGRSGMRCEEGVTVTTPSMSGAGSYLVLPALTNTHHELRLDVEFKPLEPDGI
LLFSGGKSGPVEDFVSLAMVGGHLEFRYELGSGLAVLRSLEPLALGRWHRVSAERLNKDG
SLQVDGGRPVLRSSPGKSQGLNLHTLLYLGGVEPSVQLSPATNMSAHFRGCVGEVSVNGK
RLDLTYSFLGSRGVGQCYDSSPCERQPCRNGATCMPAGEYEFQCLCQDGFKGDLCEHEEN
PCQLQEPCLNGGTCRGTRCLCLPGFSGPRCQQGAGYGVVESDWHPEGSGGNDAPGQYGAY
FHDNGFLALPGNSFSRSLPEVPETIEFEVRTSTANGLLLWQGVVKESSRSKDFISLGLQD
GHLVFNYQLGSGEARLVSEDPINDGEWHRVTALREGQRGSIQVDGEELVIGRSPGPNVAV
NTKDIIYIGGAPDVATLTRGKFSSGITGCLKNLVLHSARPGAPPPQPLDLQHRAQAGANT
RPCPS
Download sequence
Identical sequences ENSRNOP00000052803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]