SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052903 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052903
Domain Number 1 Region: 403-647
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.5e-69
Family Eukaryotic proteases 0.0000000214
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-31
Family Spermadhesin, CUB domain 0.0000776
Further Details:      
 
Domain Number 3 Region: 157-268
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-28
Family Spermadhesin, CUB domain 0.0000387
Further Details:      
 
Domain Number 4 Region: 338-411
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000445
Family Complement control module/SCR domain 0.0000193
Further Details:      
 
Domain Number 5 Region: 270-341
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000103
Family Complement control module/SCR domain 0.0000263
Further Details:      
 
Domain Number 6 Region: 112-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000547
Family EGF-type module 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052903   Gene: ENSRNOG00000011796   Transcript: ENSRNOT00000056051
Sequence length 648
Comment pep:known chromosome:Rnor_5.0:4:224144564:224154807:1 gene:ENSRNOG00000011796 transcript:ENSRNOT00000056051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYGEVTSPLYPKPYPSDLETTTVITVPTGYRVKLVFWQFDVEPSEGCFYDYVKISADKKT
LGRFCGQQDSPQGNPPGRKEFMSQGNKMLLTFHTDFSNEENGTGFLAYYQAVDLDECTSQ
PNSGCQHLCHNYVGGYFCSCRPGYELQKDRQSCQAECSSGLYTEPSGYISSLEYPKPYPP
DLRCNYSIRVERGLTVHLKFLDPFEIDDHQQVHCPYDQLQIYANGKNLGEFCGTQRPPDL
DTSSNAVDLLFFTDESGDSRGWKLRYTTEKCPQPKALDEFTIIQDPQPQYQFRDYFIVTC
KQGYQLMEGSQALLSFTAVCQHDGTWHRAMPRCKIKDCGQPRSLSNGDFRYLTTRGVNTY
EARIQYYCHDPYYKMMTRAGRIYTCTPQGIWKNEEEGEKMPRCLPVCGKPVNPVTQKQRI
IGGQKANPGNFPWQAFTNIHGRGGGALLGDRWILTAAHTIYPKEHKDVFLGHTNVEEIKK
LGHHPVRRVIIHPDYRQDEPNNFEGDIALLELENSVTLGPNLLPICLPDNETFYDKDLMG
YVSGFGITEDKIAFNLRFVRLPIADREACQRWLRTKNSNDVFSQNMFCSGDPTLKHDACQ
GDSGGVFAVRDRSRDIWVATGIVSWGIGCGEGYGFYTKLLNYVDWIKK
Download sequence
Identical sequences ENSRNOP00000052903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]