SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052910 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052910
Domain Number 1 Region: 422-670
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.44e-70
Family Eukaryotic proteases 0.000000159
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-29
Family Spermadhesin, CUB domain 0.00000144
Further Details:      
 
Domain Number 3 Region: 163-276
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-23
Family Spermadhesin, CUB domain 0.0000781
Further Details:      
 
Domain Number 4 Region: 350-426
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000334
Family Complement control module/SCR domain 0.0000404
Further Details:      
 
Domain Number 5 Region: 292-353
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000195
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 118-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000484
Family EGF-type module 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052910   Gene: ENSRNOG00000011971   Transcript: ENSRNOT00000056058
Sequence length 671
Comment pep:known chromosome:Rnor_5.0:4:224162699:224174113:-1 gene:ENSRNOG00000011971 transcript:ENSRNOT00000056058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGEILSPNYPQAYPNEVVKTWDIEVPEGFGIHLYFTHLDMELSENCAYDSVQIISGGIE
EERLCGQRTSKSPNSPIVEEFQFPYNRLQVVFTSDFSNEERFTGFAAYYSAVGVNEKTRD
VNECTDFTDVPCSHFCNNFIGGYFCSCPPEYFLHDDMRTCGVNCSGDVFTALIGEIASPN
YPNPYPENSRCEYQIRLQEGFRLVLTIRREDFDVEPAQTLHCIATSWKFAAKNQQFGPYC
GNGFPGPLTIKTQSNTLDIVFQTDLTGQNKGWKLRYHGDPIAIPCPKEISANSIWEPEKA
KYVFKDVVKITCVDGFEVVEGNVGSTSFYSTCQSNGQWSNSRLECQPVDCGVPEPIENGK
VEDPEDTVFGSVIHYTCEEPYYYMEQEEGALESIPGEYHCAANGSWVNDQLGVELPKCIP
VCGVPTEPFKVQQRIFGGYSTKIQSFPWQVYFESPRGGGALIDEYWVLTAAHVVEGNSDP
VMYVGSTLLKIERLRNAQRLITERVIIHPSWKQEDGTNFDNDIALVQLKDPVKMGPTVAP
ICLPETSSDYNPSEGDLGLISGWGRTENRTNVIQLRGAKLPITSLEKCQQVPKARSNDYV
FTDNMICAGEKGVDSCEGDSGGAFALPVPNVKDPKFYVAGLVSWGKKCGTYGIYTKVKNY
VDWILKTMQEN
Download sequence
Identical sequences ENSRNOP00000052910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]