SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053040 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053040
Domain Number 1 Region: 144-460
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.6e-125
Family Transglutaminase core 0.0000000109
Further Details:      
 
Domain Number 2 Region: 2-142
Classification Level Classification E-value
Superfamily E set domains 6.3e-43
Family Transglutaminase N-terminal domain 0.00014
Further Details:      
 
Domain Number 3 Region: 616-713
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.36e-28
Family Transglutaminase, two C-terminal domains 0.00028
Further Details:      
 
Domain Number 4 Region: 502-613
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.51e-27
Family Transglutaminase, two C-terminal domains 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053040   Gene: ENSRNOG00000011710   Transcript: ENSRNOT00000056195
Sequence length 716
Comment pep:known chromosome:Rnor_5.0:3:119538403:119565715:-1 gene:ENSRNOG00000011710 transcript:ENSRNOT00000056195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLEVALTDLQSSRNNVRHHTEEISFDRLVVRRGQAFCITLYFKNRGFQPGMDSIMFVAET
GPLPDLAKGTRAVFSLTGSGGSSPWIASLEANRANSLEVSLCAPPMAAVGRYLLKVRIDS
YQGSVTAYQLGEFILLFNPWCPADTVYLESEPQRQEYVVNDYGFIYQGSKSWIRPCPWNY
GQFEENIIDICLELLEKSLNFQVDPSTDCALRGSPVYISRVVCAMINSNDDSGVLNGNWS
ENYMDGANPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIPTRVITNFD
SGHDTDGNLIIDEYYDNTGRILENMKKDTVWNFHVWNECWMARKDLPPGYGGWQVLDATP
QETSNGLYCCGPASVKAIKEGEVDLNYDTRFAFSMVNADCMSWLVYGGKEQKLHQDTATV
GNFISTKSIQSDERDDVTENYKYEEGSLQERQVFLKALQKLQAGRSQGPHQANSNPFSSM
PPRQDSARSPTTPSLRPSDVLQVSLKFELLDSPKMGQDINFVLLAVNMSPQFKDLKLNLS
AQSLLHDGSPLAPFWQDTAFITLFPKEEKTYPCKILYSQYSQYLSTDKLIRISALGEEKS
SPEKILVNKIITLTFPGIMINVLGAAFVNQPLTVQVVFSNPLSEPVEDCVLTLEGSGLFR
KQQRVLIGVLKPHNKASITLKTVPFKSGQRQIQANLRSNRFKDIKGYKNVYVDIGL
Download sequence
Identical sequences ENSRNOP00000053040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]