SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053065 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053065
Domain Number 1 Region: 36-227
Classification Level Classification E-value
Superfamily Sec7 domain 9.29e-76
Family Sec7 domain 0.0000000512
Further Details:      
 
Domain Number 2 Region: 236-357
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-33
Family Pleckstrin-homology domain (PH domain) 0.00000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053065   Gene: ENSRNOG00000007679   Transcript: ENSRNOT00000056221
Sequence length 371
Comment pep:known chromosome:Rnor_5.0:7:119809478:119833941:1 gene:ENSRNOG00000007679 transcript:ENSRNOT00000056221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYVMQIQLSSAVARPGSYSRSNGTGSSYWRTSSRMAQKEKEMCIGRKKFNMDPAKGIQYL
TEHKLLTSDVQDIAQFLYKGEGLNKTAIGTYLGEKDPINLQVLQAFVDCHEFANLNLVQA
LRQFLWSFRLPGEAQKIDRMMEAFAARYCLCNPGVFRSTDTCYVLSFSVIMLNTGLHNPN
VRDRPHFEHFVSMNRGINSGSDLPEEQLRNLFDSIKSEPFSIPEDDGSDLTHTFFNPDRE
GWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPRGIIPLENLSVQKVDDPKKPFCLE
LYNPSCRGQKIKACKTDGDGKVVEGKHESYRISAANAEERDQWIEAIRASITRVPFYDLL
SARKKKIVGKQ
Download sequence
Identical sequences D3ZHR6
NP_001124049.1.100692 NP_001124049.1.4139 ENSRNOP00000053065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]