SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053293 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053293
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-30
Family Nuclear receptor 0.0000979
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000053293
Domain Number - Region: 75-89,238-267
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0112
Family Nuclear receptor ligand-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053293   Gene: ENSRNOG00000046831   Transcript: ENSRNOT00000056455
Sequence length 279
Comment pep:novel chromosome:Rnor_5.0:2:215105404:215107929:1 gene:ENSRNOG00000046831 transcript:ENSRNOT00000056455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPIDRTSRNR
CQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQQQQREQVAKTPPAGSHGA
DTLTYTLGVPDGQLPLGASPDLPEASACPPGLLRASGSGPPYSNTLAKTEVQGASCHLEY
SPERGKAEGRDSIYSTDGQLTLGRRGLQLGEPEQGSDSHCSPSFCSAPEAPYASLTDIEY
LVQNVCKSYRETCQLRLEDLLRQRTNLFSREEVTSYQRK
Download sequence
Identical sequences ENSRNOP00000053293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]