SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053679 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053679
Domain Number 1 Region: 15-86
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.91e-21
Family Cold shock DNA-binding domain-like 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053679   Gene: ENSRNOG00000017117   Transcript: ENSRNOT00000056836
Sequence length 282
Comment pep:known chromosome:Rnor_5.0:10:56292310:56296950:1 gene:ENSRNOG00000017117 transcript:ENSRNOT00000056836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRAGQAGSAKALAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLR
SVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRYAPNRRRFRRFIPRPRPAAPPPMV
AEAPSGGTEPGSEGERAEDSGQRPRRRRPPPFFYRRRFVRGPRPPNQQQPIEGSDGVEPK
ETTPLEGDQQQGDERVPPPRFRPRYRRPFRPRPPQQPTTEGGDGETKPSQGPTDGSRPEP
QRPRNRPYFQRRRQQPPGPRQPIAAETSAPINSGDPPTTILE
Download sequence
Identical sequences ENSRNOP00000053679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]