SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053914 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053914
Domain Number 1 Region: 2057-2137
Classification Level Classification E-value
Superfamily BEACH domain 3.01e-32
Family BEACH domain 0.00000575
Further Details:      
 
Domain Number 2 Region: 38-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.85e-30
Family Clostridium neurotoxins, the second last domain 0.013
Further Details:      
 
Domain Number 3 Region: 1944-2050
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-29
Family PreBEACH PH-like domain 0.00000262
Further Details:      
 
Domain Number 4 Region: 319-422,501-792
Classification Level Classification E-value
Superfamily ARM repeat 2.55e-21
Family PBS lyase HEAT-like repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053914   Gene: ENSRNOG00000023453   Transcript: ENSRNOT00000057084
Sequence length 2137
Comment pep:known chromosome:Rnor_5.0:2:204990264:205322437:1 gene:ENSRNOG00000023453 transcript:ENSRNOT00000057084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDLLVDMLGVLASYNLTVRELKLFFSKLQGDKGQWPPHAGKLLSVLKHMPQKYAPDAFFN
FPGKSAAAIALPPIARWPYQNGFTFHTWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAH
FVGGCLIITSIKSKGKGFQHCVKFDFKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYG
EITWFVNTSDTFDKCFLGSSETADANRVFCGQMTAVYLFSDALNAAQIFAIYQLGLGYKG
TFKFKAESDLFLAEHHKLLLYDGKLSSAIAFTYNARATDAQLCLESSPKDNPSIFVHSPH
ALMLQDVKAVLTHSIQSAMHSVGGVQVLFPLFAQLDYRQYLSDEVDLTICTTLLAFIMEL
LKNSVAMQEQMLACKGFLVIGYSLEKSSKSHVSRAVLELCLAFSKYLSNLQNGMPLLKQL
CDHVLLNPAVWIHTPAKVQLMLYTYLSTEFIGTVNIYNTVRRVGTVLLIMHTLKYYYWAV
NPQDRSGITPKGLDGPRPNQKEILSLRAFLLMFIKQLVMKDSGVKEDELQAILNYLLTMH
EDDNLMDVLQLLVALMAEHPNSMTPAFDQRNGLRVIYKLLASKSEGIRVQALKALGYFLK
HLAPKRKAEVMLGHGLFSLLAERLMLQTNLITMTMYNVLFEILIEQICTQVIHKQHPDPD
STVKIQNPQILKVIATLLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQE
WMLSLCYFNPKSSDEQKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIH
KENLANIFREEQGKGDEEIGPCSASLSPEGTGVTRDVDVSEGPQHSDRKESLISPHFTTN
SDENSSIGKASSIDSASNIELQTPGYEKKVEQGNQELLDQAAMEEATTNEAKHACDLEAS
SDAVEPVTLTSTSSEPGKDTVTISGVRASVSSPSEQDAAEMPELLENSGVEEEDGDDDYV
ELKVEGIEGSPAEEARLPAERQAEEARLPAEHQAEEACQPAERQGESVSVAASEGREEVE
VCGNGCELQEEAPITKSHNDPETGDSKESGFPTVATAGSLATSSEVPVPQTTLQPDSDEM
LGGGVKTDIAGETESVSDCADDVSEAPATSEQKIAKLDVSSVASDTERFELKASTSTEAP
QPQRHGLEISRQQEHPRQETAPDTGDQQRRDSRPTMFRIPEFKWSQMHQRLLTDLLFSIE
TDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATH
ELENVEPAQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKNMSSGGILRQCLRLV
CAVAVRNCLECQQHSQLKARGEAAKSLKAVHSLVPVGRSAAKSPVDIVTGGISPVRDLDR
LLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQDERHSQSLKE
AGSDNGTVSLPDAENTTAEFSSLTLSSVEESLEGTSSTRRRDSGLGEETASGLGSSMSVA
SPAAPLGVSTGPDAISEVLCTLSLEVNKSQETKNDGGNELDGKVTPSVPVSKNVNVKDIL
RSLVNMPADGVTVDPALLPPACLGALGDLSVDPPVQFRSFDRSVIIATKKSSVLPSTLTA
SAPSNAVSVVSSVDSTQVPDAGGESPGSRSPNAKLPSVPAVGSVPQDPVTHMSITERLEH
ALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEW
QNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCA
QYSADKREEEKMCDHLIRAAKYRDHVTATQLIQKVINLLRDKHGAWGSCAVSRPREFWRL
DYWEDDLRRRRRFVRNPLGSTHPEATLKTAVEHGSHEMVSEDQKLSFVVQAAGNPKYENP
KFTSSEMDFAWTEQRSIELLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPN
FKKIDPKILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDSATVK
KVVNYLPRVGVGTSFGLPQTRRISLATPRQLFKASNMTQRWQHREISNFEYLMFLNTIAG
RSYNDLNQYPVFPWVITNYESEELDLTLPSNFRDLSK
Download sequence
Identical sequences ENSRNOP00000053914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]