SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053934 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053934
Domain Number 1 Region: 238-346
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-28
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 175-246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.23e-17
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 2-37
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000183
Family Spermadhesin, CUB domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053934   Gene: ENSRNOG00000037640   Transcript: ENSRNOT00000057105
Sequence length 347
Comment pep:novel chromosome:Rnor_5.0:7:87398222:87640017:-1 gene:ENSRNOG00000037640 transcript:ENSRNOT00000057105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGMNIPPPIISNKNWLRLHFVTDSNHRYRGFSAPYQGSSPLTLTASIGELEKHIRTATV
ANTPADVTVSSVTAVTSHRLSEEQRVQVRSLSDSGLDPNTSEDQLSPHQADTQSTSRRPR
NAEQIERTKELAVVTHRVKKAIDFKSRGFKLFPGKDNSNKFSLLNEGGIKTASNLCPDPG
EPENGKRIGSDFSLGSTVQFSCDEDYVLQGAKSITCQRIAEVFAAWSDHRPVCKVKTCGS
NLQGPSGTFTSPNFPFQYDSNAQCVWVITAVNTNKVIQINFEEFDLEIGYDTLTIGDGGE
VGDPRTVLQVLTGSFVPDLIVSMRSQMWLHLQTDESVGSVGFKVNYK
Download sequence
Identical sequences ENSRNOP00000053934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]