SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053980 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053980
Domain Number 1 Region: 105-180
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-16
Family Complement control module/SCR domain 0.00063
Further Details:      
 
Domain Number 2 Region: 232-294
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000134
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 3 Region: 164-234
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000032
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 43-110
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000017
Family Complement control module/SCR domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053980   Gene: ENSRNOG00000007917   Transcript: ENSRNOT00000057151
Sequence length 355
Comment pep:known chromosome:Rnor_5.0:13:118334939:118366003:-1 gene:ENSRNOG00000007917 transcript:ENSRNOT00000057151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAAPLTPDPTHPRRRRKSYTFFSLGIYAEALLFLLSSLSDACEPPPPFEAMELKDKPKP
HYAIGEIIEYTCKKGYLYLSPYPMTAICQPNHTWVPISDHGCIKVQCTMLQDPSFGKVHY
IDGRFSWGARVKYTCMNGYYMVGMSVLQCELNGNGDAFWNGHPPSCKKVYCLPPPKIKNG
THTFTDIKVFKYHEAVIYSCDPNPGPDKFSLVGPSMLFCAGHNTWSSDPPECKVVKCPFP
VLQNGRQISRTEKKFSYQALVLFQCLEGFYMEGSSMVVCGAKSSWEPSIPQCLKGPKPHS
TKPPVYSESGYPSPREGIFGQEFDAWIIALIVVTSVVGVIVICLIILRCSEYRKK
Download sequence
Identical sequences Q9Z0M4
ENSRNOP00000053980 NP_062063.1.100692 NP_062063.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]