SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000054195 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000054195
Domain Number 1 Region: 35-140
Classification Level Classification E-value
Superfamily Immunoglobulin 4.29e-25
Family V set domains (antibody variable domain-like) 0.0000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000054195   Gene: ENSRNOG00000046222   Transcript: ENSRNOT00000057384
Sequence length 142
Comment pep:known chromosome:Rnor_5.0:1:84261181:84267457:1 gene:ENSRNOG00000046222 transcript:ENSRNOT00000057384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEENSVLLLAHNMPQ
EFQVFYWYKGTTPNLDSEIARYIRSDNVHQTGPAYSGRETIYSNGSLFFQNVTKKDEGAY
TLTVIDQQFNPIQTSVQFRVYP
Download sequence
Identical sequences Q64724
ENSRNOP00000027213 ENSRNOP00000027213 ENSRNOP00000054195 NP_775461.1.100692 NP_775461.1.4139 XP_008757299.1.100692 10116.ENSRNOP00000027213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]