SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000055021 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000055021
Domain Number 1 Region: 36-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000055021   Gene: ENSRNOG00000018706   Transcript: ENSRNOT00000058221
Sequence length 168
Comment pep:novel chromosome:Rnor_5.0:17:72156606:72185115:-1 gene:ENSRNOG00000018706 transcript:ENSRNOT00000058221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPQLRGCGVHALPMLLPLLLLLLLLLPLRVTPGITCPTPISIEHADIRVKNYSVNSRE
RYVCNSGFKRKAGTSTLTECVINKNTNVAHWTTPNLKCIKISPHSSEMTKVAIPTSVLLV
AAGIGLVFLTRYIKSRQASQPRRVEVETMETVPMTVRARSKEDEDHTT
Download sequence
Identical sequences ENSRNOP00000055021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]