SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000055931 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000055931
Domain Number 1 Region: 13-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000204
Family Canonical RBD 0.005
Further Details:      
 
Domain Number 2 Region: 86-124
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000523
Family Retrovirus zinc finger-like domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000055931   Gene: ENSRNOG00000028626   Transcript: ENSRNOT00000033079
Sequence length 151
Comment pep:novel chromosome:Rnor_5.0:9:53110618:53111288:1 gene:ENSRNOG00000028626 transcript:ENSRNOT00000033079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHNGQGGETKEYVGNLGTGAGKGELERAFGYCGPLRTVWIARNPPGLVFAESEDTRDAE
DAIQGLDGKVICGSRVELSTGLSQRSQFDRPSAHHPFDHNDRCYEYGEKGHYVYDCHRYS
RQRRRSISRSRSISRPRSRSPFPKRSHFPSG
Download sequence
Identical sequences ENSRNOP00000055931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]