SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056031 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056031
Domain Number 1 Region: 544-576,712-786
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000597
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000056031
Domain Number - Region: 163-294
Classification Level Classification E-value
Superfamily Thiolase-like 0.0453
Family Thiolase-related 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056031   Gene: ENSRNOG00000000512   Transcript: ENSRNOT00000059264
Sequence length 973
Comment pep:known chromosome:Rnor_5.0:20:7916763:7962295:-1 gene:ENSRNOG00000000512 transcript:ENSRNOT00000059264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTERSSQGFGNRYRQIPFMYDVKRSVYNEENFQQEHRRKGPTSGNMDINITTFKHHVQC
RCSWHKFLRCMLTVFPFLEWMCLYRFKDWLLGDLLAGLSVGLVQVPQGLTLSLLTRQLIP
PLNVAYAAFCSSVIYVIFGSCHQMSIGPFFLVSALMINVLKERPFNNGHLIMGTFVKDDF
SVPTFYLNYNRSLSMVASTTFLTGIIQLSMGMLGMGFVATYLPEAATSAYLAAVALHIIL
AQMTCIFGIMVSFHAGPIAFIYNIINYCIALPKANSTSILLFLTAVVALRVNKCIRISFN
RYPIEFPMELLLILGFSMLTSRITMATENSKMLINMIPYSFVFPETPEFGILSRIVLQAL
SLSVVSSFLLISLGKKIANLHNYRTNSNQDLIAIGLCNLVSSFFRCCVFTGGMARTIIQD
KSGGRQQFASLVGAGVMLLLMVKIGSFFDNLPNAVLAGIILSNVVPYLETIYNLPTLWRQ
DQYECVVWMVTFSAAIFLGLDVGLLISLVFTFFVITVRSHRTKILVLGQIPNTNIYRNVN
EYREVILIPGVKILQCCSSITFVNVYHLKHKLLKEVNMVKLPLKEEEIYALFHESETSIA
ENKLCRCFCDCEELEPESRVVYTERYENKQEHGSSINLIRCSYLGSGDSSQTTSEEQVPY
TVSSTSQRNIGQNYEDTEKAWLPNSPPRNSSLPPPENSESLAQSRSRSVILPYSDTHTII
LDFSMVHYVDNRALVVLRQMCNAFHNADILVLISGCHTSVVKLFEKNDFFDDGITKAQLF
LSLHDAVLFALSRKCSEPSDLSVDETETVIQETYSESDKNDNLSNLRFKPGNVIMEGSQH
ASPNYTKTHRPAKNDLEFDLDPDRLLASDQTSGMDLNLDLDLDLGRESDLDPGSELGSEI
QAKPELESELEIDVQTEPETEEESERERKSQPRTRTRAQSPWQSYLTAYRFGSTSSQSAG
PPQTPQTRPAEKR
Download sequence
Identical sequences F7F9X9
ENSRNOP00000056031 XP_003751981.1.100692 XP_003753515.1.4139 XP_008771001.1.100692 XP_008773136.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]