SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056220 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056220
Domain Number 1 Region: 754-941
Classification Level Classification E-value
Superfamily Sec7 domain 2.09e-64
Family Sec7 domain 0.00000725
Further Details:      
 
Domain Number 2 Region: 957-1079
Classification Level Classification E-value
Superfamily PH domain-like 0.000004
Family Pleckstrin-homology domain (PH domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056220   Gene: ENSRNOG00000003466   Transcript: ENSRNOT00000059465
Sequence length 1472
Comment pep:novel chromosome:Rnor_5.0:X:64287088:64367249:-1 gene:ENSRNOG00000003466 transcript:ENSRNOT00000059465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGSGPPGGPGSESPNRAVEYLLELNNIIESQQQLLETQRRRIEELEGQLDQLTQENRD
LREESQLHRGELHRDPLGARDSPGRESQYQNLRETQFHHRELRESQFHQASRDVGYPNRD
GAYQNREAIYRDKEREASYQLQDTTGYTARERDVAQCHLHHENPALGRERGGREAGPAHP
GREKEAGYSAAVGVGQRPPRERGQLSRGASRSSSPGAGGGHSTSTSTSPATTLQRKSDGE
NSRTVSVEGDAPGSDLSTAVDSPGSQPPYRLSQLPPTSSHMGGPPAGVGLPWSQRARLQP
ASVALRKQEEEEIKRSKALSDSYELSTDLQDKKVEMLERKYGGSFLSRRAARTIQTAFRQ
YRMNKNFERLRSSASESRMSRRIILSNMRMQFSFEEYEKAQNPAYFEGKPASLDEGAMAG
ARSHRLERGLPYGGSCGGGIDGGGSSVTTSGEFSNDITELEDSFSKQVKSLAESIDEALN
CHPSGPMSEEPGSAQLEKRESKEQQEDSSATSFSDLPLYLDDPVPPPSPERLPSTEPPPQ
GRPEFWAPAPLPPVPPPMPPGTREDGSREEGTRRGPGCLECRDFRLRAAHLPLLTIEPPS
DSSVDLSDRSDRGSVHRQLVYEADGCSPHGTLKHKGPPGRAPIPHRHYPAPEGPAPAPPG
PLPPAPNSGTGPSGVAGGRRLGKCEAAGENSDGGDNESLESSSNSNETINCSSGSSSRDS
LREPPATGLCKQTYQRETRHSWDSPAFNNDVVQRRHYRIGLNLFNKKPEKGIQYLIERGF
LSDTPVGVAHFILERKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSSMDLDDALRKF
QSHIRVQGEAQKVERLIEAFSQRYCVCNPALVRQFRNPDTIFILAFAIILLNTDMYSPSV
KAERKMKLDDFIKNLRGVDNGEDIPRDLLVGIYQRIQGRELRTNDDHVSQVQAVERMIVG
KKPVLSLPHRRLVCCCQLYEVPDPNRPQRLGLHQREVTKIFQKKKILVTYSFRQSFPLVE
MHMQLFQNSYYQFGIKLLSAVPGGERKVLIIFNAPSLQDRLRFTSDLRESIAEVQEMEKY
RVESELEKQKGMMRPNASQPGGAKDSVNGTLARSSLEDTYGAGDGLKRGALSSSLRDLSD
AGKRGRRNSVGSLDSTIEVSVSSCPTHFCMSPALAIEPPTTFSICPQLCLSSLCLSLSLS
STLPCPFSTPGPTPNRDALGFGPQETLTSRSCFFLRNGHAKEVLLIFPLPSEVQQNLGAE
LATNTGLLFGFHCTLESLLLQLQGQTSPPPPFQGSVISSPRPHQRMPPPPPPPPPEEYKS
QRPVSNSSSFLGSHPQFAPHGRHPLHQPTSPLPLYSPAPQHPPAHKQGPKHFIFSHHPQM
MPAAGAAGGPGSRPPGGSYSHPHHPQSPLSPHSPIPPHPSYPPLPPPSPHTPHSPLPPTS
PHGPLHASGPPGTANPPSANPKAKPSRISTVV
Download sequence
Identical sequences ENSRNOP00000056220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]