SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056429 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056429
Domain Number 1 Region: 16-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.95e-72
Family Eukaryotic proteases 0.000000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056429   Gene: ENSRNOG00000020647   Transcript: ENSRNOT00000059677
Sequence length 250
Comment pep:known chromosome:Rnor_5.0:15:38998316:39000903:-1 gene:ENSRNOG00000020647 transcript:ENSRNOT00000059677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPLLFLLIFVLFQEDEAGKIIGGREARPNSHPYMAFLLIQSPEGLSACGGFLVREDFVL
TAGHCFGSSINVTLGAHNIRRQEGTQQHITVLRAIRHPDYNPPPVIQNDIMLLQLRSRAR
RSRAVKPVALPQATKRVQPGALCTVAGWGLVSQRRGTNVLQEVKLRVQTDQTCANRFQFY
NSQTQICVGNPRERKSAFKGDSGGPLVCNNVAQGIVSYGSSSGNPPAVFTRIQSFMPWIK
RTMRRLSSRY
Download sequence
Identical sequences G3V9Q7
ENSRNOP00000056429 NP_001099511.1.100692 NP_001099511.1.4139 ENSRNOP00000056429 10116.ENSRNOP00000056429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]