SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056560 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056560
Domain Number 1 Region: 306-420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-38
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 150-259
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 3 Region: 475-587
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.27e-27
Family Frizzled cysteine-rich domain 0.00035
Further Details:      
 
Domain Number 4 Region: 263-300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000056560   Gene: ENSRNOG00000039107   Transcript: ENSRNOT00000059813
Sequence length 590
Comment pep:known chromosome:Rnor_5.0:8:47054088:47059250:1 gene:ENSRNOG00000039107 transcript:ENSRNOT00000059813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEYADVTLCPEAAELSKTEFCNPAFDLEAGPSCPPPALQKNVSSSLQGPWHVQRLRGLQ
PDCHFSGLCILLLSGLLLLLLGLLVAVILAQLQATSLPRTTKNPLPTRGGLTPTGVIPST
TPNTTTTTTTTPAITGRQEAAMSPTHQTTCGGLLPGPSGFFSSPNYPDLYPPHSHCVWHI
QVATGQTIQLKIQVLSTESMLACLFDRLEISPAPTGPLLRMCGKTPPATVNTNTSHLRVS
FVSDNDVEGSGFQAWYQAVAPGHWSCTHYEFHCDLLLCLKQDSVCDGIKDCIDGSDEANC
SAKTLGCGGNLTELSGVFSTPNYPQHYPHQQLCTWYIKVPVGYRIRLEFHNFSLEEQTEC
KFDYVEVYEASNSGTFSSLGRFCGAEPPSHLVSSQHQLTVIFKTDLGISSGGFLATYQAI
NTTESGCPWADLCGPREFCQSRVRRELQRICDLWKDCANDSNDNCNSHLSPQLDLTCEPV
QVEMCLGLSYNTTAFPNIWVGLATQMEVTDILRGYKSLTSLPCYQTFRRFLCGLLEPRCT
SLGTILPPCRSVCQEAEQQCQSSLALLGIPWPFNCNRLPVPASLEACSQP
Download sequence
Identical sequences D3ZU82
ENSRNOP00000056560 10116.ENSRNOP00000056560 ENSRNOP00000056560 NP_001101607.1.100692 NP_001101607.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]